- Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0236 (AF_0236)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1249576
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 4,683 Da
- E Coli or Yeast
- 14611
- Uncharacterized protein AF_0236 (AF_0236)
Sequence
MVIAAMLVPFVAIRSHDMTTYLYWTAVTAAYLTYLTIKRW